Database accession: MF7000839
Name: Osmotically inducible protein C (Thermus thermophilus)
PDB ID: 1ukk
Experimental method: X-ray (1.60 Å)
Assembly: Homodimer
Source organism: Thermus thermophilus
Primary publication of the structure:
Rehse PH, Ohshima N, Nodake Y, Tahirov TH
Crystallographic structure and biochemical analysis of the Thermus thermophilus osmotically inducible protein C.
(2004) J. Mol. Biol. 338: 959-68
PMID: 15111059
Abstract:
The X-ray crystallographic structure of osmotically inducible Protein C from the thermophilic bacterium, Thermus thermophilus HB8, was solved to 1.6A using the multiple wavelength anomalous dispersion method and a selenomethionine incorporated protein (Se-MAD). The crystal space group was P1 with cell dimensions of a=37.58 A, b=40.95 A, c=48.14 A, alpha=76.9 degrees, beta=74.0 degrees and gamma=64.1 degrees. The two tightly interacting monomers in the asymmetric unit are related by a non-crystallographic 2-fold. The dimer structure is defined primarily by two very long anti-parallel, over-lapping alpha-helices at the core, with a further six-stranded anti-parallel beta-sheet on the outside of the structure. With respect to the beta-sheets, both A and B monomers contribute three strands each resulting in an intertwining of the structure. The active site consists of two cysteine residues from one monomer and an arginine and glutamic acid from the other. Enzymatic assays have revealed that T.thermophilus OsmC has a hydroperoxide peroxidase activity.
Annotations from the GeneOntology database. Only terms that fit at least two of the interacting proteins are shown. Molecular function:
peroxidase activity peroxidase activity
Biological process:
response to oxidative stress response to oxidative stress
Cellular component: not assigned
Structural annotations of the participating protein chains.Entry contents: 2 distinct polypeptide molecules
Chains: A, B
Notes: All chains according to the most probable oligomerization state stored in PDBe were considered.
Number of unique protein segments: 1
Name: Osmotically inducible protein C
Source organism: Thermus thermophilus
Length: 142 residues
Sequence:Sequence according to the corresponding UniProt protein segmentMPVRKAKAVWEGGLRQGKGVMELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGXFSMALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTRIELLTEAEVPGISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARLV
UniProtKB AC: P84124 (positions: 2-142)
Coverage: 99%
Name: Osmotically inducible protein C
Source organism: Thermus thermophilus
Length: 142 residues
Sequence:Sequence according to the corresponding UniProt protein segmentMPVRKAKAVWEGGLRQGKGVMELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGXFSMALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTRIELLTEAEVPGISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARLV
UniProtKB AC: P84124 (positions: 2-142)
Coverage: 99%
Evidence demonstrating that the participating proteins are unstructured prior to the interaction and their folding is coupled to binding. Representative domain in related structures: OsmC-like protein
Evidence level: Direct evidence
Evidence coverage: The full structure participates in mutual synergistic folding.
Complex Evidence:
Ohr is a tightly folded homodimer with a large buried hydrophobic surface area. The two monomers are tightly wrapped around each other in a head-to-tail orientation. Dimerization is dominated by helix–helix packing interactions of two long helices at the center of the hydrophobic core of the dimeric enzyme. Also, each β-sheet is composed of six strands, three from one monomer and three from the other (beta sheet augmentation). The hydrophobic core, as well as the surrounding β-sheets, are generated by combining elements of both monomers, therefore, it is clear that the two polypeptide chains have to fold together to form active Ohr, and that each monomer would individually be unstable. The two active sites are also located at the dimer interface (PMID:12485986).
Chain A:
N/A
Chain B:
N/A
Surface and contacts features:
Structures from the PDB that contain the same number of proteins, and the proteins from the two structures show a sufficient degree of pairwise similarity, i.e. they belong to the same UniRef90 cluster (the full proteins exhibit at least 90% sequence identity) and convey roughly the same region to their respective interactions (the two regions from the two proteins share a minimum of 70% overlap). Download the CIF file (.cif)
Download this entry's XML file (.xml)
Download this entry's JSON file (.json)
