{"entry": {"accession": "MF7000839", "general": {"name": "Osmotically inducible protein C (Thermus thermophilus)", "pdb_id": "1ukk", "exp_method": "X-ray", "resolution": "1.60", "assembly": "Homodimer", "source_organism": "Thermus thermophilus", "publication": {"pmid": "15111059", "authors": "Rehse PH, Ohshima N, Nodake Y, Tahirov TH", "title": "Crystallographic structure and biochemical analysis of the Thermus thermophilus osmotically inducible protein C.", "journal": "J. Mol. Biol.", "year": "2004", "issue": "5", "volume": "338", "pages": "959-68", "abstract": "The X-ray crystallographic structure of osmotically inducible Protein C from the thermophilic bacterium, Thermus thermophilus HB8, was solved to 1.6A using the multiple wavelength anomalous dispersion method and a selenomethionine incorporated protein (Se-MAD). The crystal space group was P1 with cell dimensions of a=37.58 A, b=40.95 A, c=48.14 A, alpha=76.9 degrees, beta=74.0 degrees and gamma=64.1 degrees. The two tightly interacting monomers in the asymmetric unit are related by a non-crystallographic 2-fold. The dimer structure is defined primarily by two very long anti-parallel, over-lapping alpha-helices at the core, with a further six-stranded anti-parallel beta-sheet on the outside of the structure. With respect to the beta-sheets, both A and B monomers contribute three strands each resulting in an intertwining of the structure. The active site consists of two cysteine residues from one monomer and an arginine and glutamic acid from the other. Enzymatic assays have revealed that T.thermophilus OsmC has a hydroperoxide peroxidase activity."}}, "function": {"molecular_function": {"go": {"accession": "GO:0004601", "name": "peroxidase activity"}}, "biological_process": {"go": {"accession": "GO:0006979", "name": "response to oxidative stress"}}}, "macromolecules": {"general": {"nr_of_chains": "2", "nr_of_unique_protein_segments": "1", "class": "Homooligomeric enzymes", "subclass": "Homodimeric enzymes", "note": "All chains according to the most probable oligomerization state stored in PDBe were considered."}, "chain": [{"id": "A", "name": "Osmotically inducible protein C", "source_organism": "Thermus thermophilus", "uniprot": {"id": "P84124", "start": "2", "end": "142", "coverage": "99%", "sequence": "MPVRKAKAVWEGGLRQGKGVMELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGXFSMALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTRIELLTEAEVPGISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARLV", "length": "142"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "24", "region_end": "27"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "34", "region_end": "39"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "45", "region_end": "69"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "108", "region_end": "120"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "123", "region_end": "129"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "3", "region_end": "11"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "18", "region_end": "23"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "28", "region_end": "33"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "75", "region_end": "85"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "92", "region_end": "103"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "134", "region_end": "141"}, {"region_type": "pfam", "region_id": "PF02566", "region_name": "OsmC-like protein", "region_start": "40", "region_end": "131"}]}}, {"id": "B", "name": "Osmotically inducible protein C", "source_organism": "Thermus thermophilus", "uniprot": {"id": "P84124", "start": "2", "end": "142", "coverage": "99%", "sequence": "MPVRKAKAVWEGGLRQGKGVMELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGXFSMALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTRIELLTEAEVPGISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARLV", "length": "142"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "34", "region_end": "39"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "45", "region_end": "69"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "108", "region_end": "120"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "123", "region_end": "129"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "3", "region_end": "11"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "18", "region_end": "23"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "29", "region_end": "33"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "75", "region_end": "86"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "91", "region_end": "103"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "134", "region_end": "141"}, {"region_type": "pfam", "region_id": "PF02566", "region_name": "OsmC-like protein", "region_start": "40", "region_end": "131"}]}}]}, "evidence": {"evidence_level": "Direct evidence", "evidence_coverage": "The full structure participates in mutual synergistic folding.", "sequence_domain": "OsmC-like protein", "complex_evidence": "Ohr is a tightly folded homodimer with a large buried hydrophobic surface area. The two monomers are tightly wrapped around each other in a head-to-tail orientation. Dimerization is dominated by helix\u2013helix packing interactions of two long helices at the center of the hydrophobic core of the dimeric enzyme. Also, each \u03b2-sheet is composed of six strands, three from one monomer and three from the other (beta sheet augmentation). The hydrophobic core, as well as the surrounding \u03b2-sheets, are generated by combining elements of both monomers, therefore, it is clear that the two polypeptide chains have to fold together to form active Ohr, and that each monomer would individually be unstable. The two active sites are also located at the dimer interface (PMID:12485986).", "chain_evidence": [{"chain_id": "A", "support": "N/A"}, {"chain_id": "B", "support": "N/A"}]}, "related_structures": {"id": ["MF7000837", "MF7000838", "MF7000839", "MF7000840", "MF7000841", "MF7000842", "MF7000843"]}}}