General Information

Database accession: MF7000895

Name: Triosephosphate Isomerase (Deinococcus radiodurans)

PDB ID: 4y90 PDBe

Experimental method: X-ray (2.10 Å)

Assembly: Homodimer

Source organism: Deinococcus radiodurans

Primary publication of the structure:

Romero-Romero S, Costas M, Rodríguez-Romero A, Alejandro Fernández-Velasco D
Reversibility and two state behaviour in the thermal unfolding of oligomeric TIM barrel proteins.

(2015) Phys Chem Chem Phys 17: 20699-714

PMID: 26206330 PubMed

Abstract:

Temperature is one of the main variables that modulate protein function and stability. Thermodynamic studies of oligomeric proteins, the dominant protein natural form, have been often hampered because irreversible aggregation and/or slow reactions are common. There are no reports on the reversible equilibrium thermal unfolding of proteins composed of (β/α)8 barrel subunits, albeit this "TIM barrel" topology is one of the most abundant and versatile in nature. We studied the eponymous TIM barrel, triosephosphate isomerase (TIM), belonging to five species of different bacterial taxa. All of them were found to be catalytically efficient dimers. The three-dimensional structure of four enzymes was solved at high/medium resolution. Irreversibility and kinetic control were observed in the thermal unfolding of two TIMs, while for the other three the thermal unfolding was found to follow a two-state equilibrium reversible process. Shifts in the global stability curves of these three proteins are related to the organismal temperature range of optimal growth and modulated by variations in maximum stability temperature and in the enthalpy change at that temperature. Reversibility appears to correlate with the low isoelectric point, the absence of a residual structure in the unfolded state, small cavity volume in the native state, low conformational stability and a low melting temperature. Furthermore, the strong coupling between dimer dissociation and monomer unfolding may reduce aggregation and favour reversibility. It is therefore very thought-provoking to find that a common topological ensemble, such as the TIM barrel, can unfold/refold in the Anfinsen way, i.e. without the help of the cellular machinery.


Function and Biology Annotations from the GeneOntology database. Only terms that fit at least two of the interacting proteins are shown.

Molecular function:

triose-phosphate isomerase activity triose-phosphate isomerase activity GeneOntology

Biological process:

gluconeogenesis gluconeogenesis GeneOntology

glyceraldehyde-3-phosphate biosynthetic process glyceraldehyde-3-phosphate biosynthetic process GeneOntology

glycerol catabolic process glycerol catabolic process GeneOntology

glycolytic process glycolytic process GeneOntology

Cellular component:

cytosol cytosol GeneOntology

Structure Summary Structural annotations of the participating protein chains.

Entry contents: 2 distinct polypeptide molecules

Chains: A, B

Notes: All chains according to the most probable oligomerization state stored in PDBe were considered.

Number of unique protein segments: 1


Chain A

Name: Triosephosphate isomerase

Source organism: Deinococcus radiodurans

Length: 244 residues

Sequence:Sequence according to the corresponding UniProt protein segmentMQTLLALNWKMNKTPTEARSWAEELTTKYAPAEGVDLAVLAPALDLSALAANLPAGIAFGGQDVSAHESGAYTGEISAAMLKDAGASCVVVGHSERREYHDESDAXVAAKARQAQANGLLPIVCVGENLDVRERGEHVPQTLAQLRGSLEGVGADVVVAYEPVWAIGTGKTATADDAEELAAAIRGALREQYGARAEGIRVLYGGSVKPENIAEICGKPNVNGALVGGASLKVPDVLGMLDALR

UniProtKB AC: Q9RUP5 (positions: 1-244) UniProt

Coverage: 100%

Chain B

Name: Triosephosphate isomerase

Source organism: Deinococcus radiodurans

Length: 244 residues

Sequence:Sequence according to the corresponding UniProt protein segmentMQTLLALNWKMNKTPTEARSWAEELTTKYAPAEGVDLAVLAPALDLSALAANLPAGIAFGGQDVSAHESGAYTGEISAAMLKDAGASCVVVGHSERREYHDESDAXVAAKARQAQANGLLPIVCVGENLDVRERGEHVPQTLAQLRGSLEGVGADVVVAYEPVWAIGTGKTATADDAEELAAAIRGALREQYGARAEGIRVLYGGSVKPENIAEICGKPNVNGALVGGASLKVPDVLGMLDALR

UniProtKB AC: Q9RUP5 (positions: 1-244) UniProt

Coverage: 100%

Evidence Evidence demonstrating that the participating proteins are unstructured prior to the interaction and their folding is coupled to binding.

Representative domain in related structures: Triosephosphate isomerase

Evidence level: Direct evidence

Evidence coverage: The full structure participates in mutual synergistic folding.

Complex Evidence:

Two-state unfolding behavior was proved experimentally for sveral members of the family. Isolated monomers are not stable at all. (PMID:15037083, PMID:10785370, PMID:26206330).

Chain A:

N/A

Chain B:

N/A

Surface and contacts features:

Related Structure(s) Structures from the PDB that contain the same number of proteins, and the proteins from the two structures show a sufficient degree of pairwise similarity, i.e. they belong to the same UniRef90 cluster (the full proteins exhibit at least 90% sequence identity) and convey roughly the same region to their respective interactions (the two regions from the two proteins share a minimum of 70% overlap).

There are 5 related structures in the MFIB database:
The molecule viewer shows our modified stucture.

Download the CIF file (.cif)

Download this entry's XML file (.xml)

Download this entry's JSON file (.json)