<?xml version="1.0" encoding="UTF-8"?>
<entry>
	<accession>MF7000859</accession>
	<general>
		<name>CafB, Zn-bound form (Aspergillus fumigatus)</name>
		<pdb_id>7cxy</pdb_id>
		<exp_method>X-ray</exp_method>
		<resolution>2.20</resolution>
		<assembly>Homodimer</assembly>
		<source_organism>Aspergillus fumigatus</source_organism>
		<publication>
			<pmid>33545350</pmid>
			<authors>Kim S, Yeon J, Sung J, Kim NJ, Hong S, Jin MS</authors>
			<title>Structural insights into novel mechanisms of inhibition of the major β-carbonic anhydrase CafB from the pathogenic fungus Aspergillus fumigatus.</title>
			<journal>J. Struct. Biol.</journal>
			<year>2021</year>
			<issue>1</issue>
			<volume>213</volume>
			<pages>107700</pages>
			<abstract>In fungi the β-class of carbonic anhydrases (β-CAs) are zinc metalloenzymes that are essential for growth, survival, differentiation, and virulence. Aspergillus fumigatus is the most important pathogen responsible for invasive aspergillosis and possesses two major β-CAs, CafA and CafB. Recently we reported the biochemical characterization and 1.8 Å crystal structure of CafA. Here, we report a crystallographic analysis of CafB revealing the mechanism of enzyme catalysis and establish the relationship of this enzyme to other β-CAs. While CafA has a typical open conformation, CafB, when exposed to acidic pH and/or an oxidative environment, has a novel type of active site in which a disulfide bond is formed between two zinc-ligating cysteines, expelling the zinc ion and stabilizing the inactive form of the enzyme. Based on the structural data, we generated an oxidation-resistant mutant (Y159A) of CafB. The crystal structure of the mutant under reducing conditions retains a catalytic zinc at the expected position, tetrahedrally coordinated by three residues (C57, H113 and C116) and an aspartic acid (D59), and replacing the zinc-bound water molecule in the closed form. Furthermore, the active site of CafB crystals grown under zinc-limiting conditions has a novel conformation in which the solvent-exposed catalytic cysteine (C116) is flipped out of the metal coordination sphere, facilitating release of the zinc ion. Taken together, our results suggest that A. fumigatus use sophisticated activity-inhibiting strategies to enhance its survival during infection.</abstract>
		</publication>
	</general>
	<function>
		<molecular_function>
			<go>
				<accession>GO:0004089</accession>
				<name>carbonate dehydratase activity</name>
			</go>
			<go>
				<accession>GO:0008270</accession>
				<name>zinc ion binding</name>
			</go>
		</molecular_function>
		<cellular_component>
			<go>
				<accession>GO:0005737</accession>
				<name>cytoplasm</name>
			</go>
		</cellular_component>
		<biological_process>
			<go>
				<accession>GO:0015976</accession>
				<name>carbon utilization</name>
			</go>
			<go>
				<accession>GO:0071244</accession>
				<name>cellular response to carbon dioxide</name>
			</go>
			<go>
				<accession>GO:0034599</accession>
				<name>cellular response to oxidative stress</name>
			</go>
		</biological_process>
	</function>
	<macromolecules>
		<general>
			<nr_of_chains>2</nr_of_chains>
			<nr_of_unique_protein_segments>1</nr_of_unique_protein_segments>
			<class>Homooligomeric enzymes</class>
			<subclass>Homodimeric enzymes</subclass>
			<note>All chains according to the most probable oligomerization state stored in PDBe were considered.</note>
		</general>
		<chain>
			<id>A</id>
			<name>Carbonic anhydrase</name>
			<source_organism>Aspergillus fumigatus</source_organism>
			<uniprot>
				<id>A4DA32</id>
				<start>9</start>
				<end>222</end>
				<coverage>93%</coverage>
				<sequence>MEPSDQKVDTVPQYLKQSHERIFENNRAWVATKMKDDPAFFEKLSAGQTPEYLYIGCSDSRVPANEIMGLEAGEVFVHRNIANLVPNTDLNVMSVINYAVRHLQVKHIVVCGHYHCGGVKAALTPSDLGLLNPWLRNVRDVYRLHEQELDGIQDATARYRRLVELNVIESCRNVIKTAAVQQSFHERQFPVVHGWIFDVETGLLRDLEIDFEETLRDIKKIYNLAPGS</sequence>
				<length>228</length>
			</uniprot>
			<regions>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>12</region_start>
					<region_end>37</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>39</region_start>
					<region_end>45</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>63</region_start>
					<region_end>68</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>89</region_start>
					<region_end>102</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>116</region_start>
					<region_end>124</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>130</region_start>
					<region_end>151</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>154</region_start>
					<region_end>176</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>177</region_start>
					<region_end>188</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>210</region_start>
					<region_end>220</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>strand</region_name>
					<region_start>52</region_start>
					<region_end>57</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>strand</region_name>
					<region_start>75</region_start>
					<region_end>80</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>strand</region_name>
					<region_start>107</region_start>
					<region_end>113</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>strand</region_name>
					<region_start>191</region_start>
					<region_end>197</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>strand</region_name>
					<region_start>204</region_start>
					<region_end>206</region_end>
				</region>
				<region>
					<region_type>pfam</region_type>
					<region_id>PF00484</region_id>
					<region_name>Carbonic anhydrase</region_name>
					<region_start>52</region_start>
					<region_end>203</region_end>
				</region>
			</regions>
		</chain>
		<chain>
			<id>B</id>
			<name>Carbonic anhydrase</name>
			<source_organism>Aspergillus fumigatus</source_organism>
			<uniprot>
				<id>A4DA32</id>
				<start>16</start>
				<end>222</end>
				<coverage>90%</coverage>
				<sequence>MEPSDQKVDTVPQYLKQSHERIFENNRAWVATKMKDDPAFFEKLSAGQTPEYLYIGCSDSRVPANEIMGLEAGEVFVHRNIANLVPNTDLNVMSVINYAVRHLQVKHIVVCGHYHCGGVKAALTPSDLGLLNPWLRNVRDVYRLHEQELDGIQDATARYRRLVELNVIESCRNVIKTAAVQQSFHERQFPVVHGWIFDVETGLLRDLEIDFEETLRDIKKIYNLAPGS</sequence>
				<length>228</length>
			</uniprot>
			<regions>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>16</region_start>
					<region_end>37</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>39</region_start>
					<region_end>46</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>63</region_start>
					<region_end>68</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>89</region_start>
					<region_end>102</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>116</region_start>
					<region_end>124</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>130</region_start>
					<region_end>151</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>154</region_start>
					<region_end>176</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>177</region_start>
					<region_end>188</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>210</region_start>
					<region_end>220</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>strand</region_name>
					<region_start>52</region_start>
					<region_end>57</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>strand</region_name>
					<region_start>75</region_start>
					<region_end>80</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>strand</region_name>
					<region_start>107</region_start>
					<region_end>113</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>strand</region_name>
					<region_start>191</region_start>
					<region_end>197</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>strand</region_name>
					<region_start>204</region_start>
					<region_end>206</region_end>
				</region>
				<region>
					<region_type>pfam</region_type>
					<region_id>PF00484</region_id>
					<region_name>Carbonic anhydrase</region_name>
					<region_start>52</region_start>
					<region_end>203</region_end>
				</region>
			</regions>
		</chain>
	</macromolecules>
	<evidence>
		<evidence_level>Indirect evidence</evidence_level>
		<evidence_coverage>The full structure participates in mutual synergistic folding.</evidence_coverage>
		<sequence_domain>Carbonic anhydrase</sequence_domain>
		<complex_evidence>The native carbonic anhydrase is dimeric in solution, in agreement with being a tightly associated dimer with a large, hydrophobic buried surface area. The extended β-sheet core consisting of ten β–strands is equally contributed by the two monomers, and the N-terminal helix of each monomer extends around the other monomer. Based on the highly intertwined structure, the monomeric form is most probably not a stable, independently folding unit. The two active sites are also located in clefts at the dimeric interface, further suggesting that dimer is the functional form (PMID:32515610).</complex_evidence>
		<chain_evidence>
			<chain_id>A</chain_id>
			<support>N/A</support>
		</chain_evidence>
		<chain_evidence>
			<chain_id>B</chain_id>
			<support>N/A</support>
		</chain_evidence>
	</evidence>
	<related_structures>
		<id>MF7000278</id>
		<id>MF7000279</id>
		<id>MF7000856</id>
		<id>MF7000857</id>
		<id>MF7000858</id>
		<id>MF7000859</id>
	</related_structures>
</entry>
