MF7000821 TM107 1ilv X-ray 2.00 Homodimer Thermotoga maritima 11709173 Zhang RG, Skarina T, Katz JE, Beasley S, Khachatryan A, Vyas S, Arrowsmith CH, Clarke S, Edwards A, Joachimiak A, Savchenko A Structure 2001 11 9 1095-106 GO:0008254 3'-nucleotidase activity GO:0008253 5'-nucleotidase activity GO:0004309 exopolyphosphatase activity GO:0046872 metal ion binding GO:0000166 nucleotide binding GO:0106411 XMP 5'-nucleosidase activity GO:0005737 cytoplasm 2 1 Homooligomeric enzymes Homodimeric enzymes All chains according to the most probable oligomerization state stored in PDBe were considered. A 5'-nucleotidase SurE Thermotoga maritima P96112 1 246 99% MRILVTNDDGIQSKGIIVLAELLSEEHEVFVVAPDKERSATGHSITIHVPLWMKKVFISERVVAYSTTGTPADCVKLAYNVVMDKRVDLIVSGVNRGPNMGMDILHSGTVSGAMEGAMMNIPSIAISSANYESPDFEGAARFLIDFLKEFDFSLLDPFTMLNINVPAGEIKGWRFTRQSRRRWNDYFEERVSPFGEKYYWMMGEVIEDDDRDDVDYKAVREGYVSITPIHPFLTNEQCLKKLREVYD 247 secondary structure helix 13 25 secondary structure helix 70 82 secondary structure helix 100 106 secondary structure helix 107 119 secondary structure helix 135 148 secondary structure helix 151 155 secondary structure helix 214 221 secondary structure helix 235 246 secondary structure strand 2 6 secondary structure strand 28 34 secondary structure strand 53 59 secondary structure strand 62 67 secondary structure strand 89 96 secondary structure strand 123 128 secondary structure strand 160 165 secondary structure strand 172 175 secondary structure strand 182 191 secondary structure strand 197 206 secondary structure strand 223 229 pfam PF01975 Survival protein SurE 3 184 A-2 5'-nucleotidase SurE Thermotoga maritima P96112 1 247 100% MRILVTNDDGIQSKGIIVLAELLSEEHEVFVVAPDKERSATGHSITIHVPLWMKKVFISERVVAYSTTGTPADCVKLAYNVVMDKRVDLIVSGVNRGPNMGMDILHSGTVSGAMEGAMMNIPSIAISSANYESPDFEGAARFLIDFLKEFDFSLLDPFTMLNINVPAGEIKGWRFTRQSRRRWNDYFEERVSPFGEKYYWMMGEVIEDDDRDDVDYKAVREGYVSITPIHPFLTNEQCLKKLREVYD 247 pfam PF01975 Survival protein SurE 3 184 Direct evidence The full structure participates in mutual synergistic folding. Survival protein SurE Two-state thermal unfolding (PMID:23409101). Domain-swapped dimer with extensive swap region and large dimer interface. Dimeric in solution (gel filtration, DLS). A N/A A-2 N/A MF7000821 MF7000221 MF7000222 MF7000224 MF7000227 MF7000223 MF7000225 MF7000226