<?xml version="1.0" encoding="UTF-8"?>
<entry>
	<accession>MF7000384</accession>
	<general>
		<name>Dpb4/Dpb3 complex</name>
		<pdb_id>5y26</pdb_id>
		<exp_method>X-ray</exp_method>
		<resolution>2.00</resolution>
		<assembly>Heterodimer</assembly>
		<source_organism>Schizosaccharomyces pombe</source_organism>
		<publication>
			<pmid>29109278</pmid>
			<authors>He H, Li Y, Dong Q, Chang AY, Gao F, Chi Z, Su M, Zhang F, Ban H, Martienssen R, Chen YH, Li F</authors>
			<title>Coordinated regulation of heterochromatin inheritance by Dpb3-Dpb4 complex.</title>
			<journal>Proc. Natl. Acad. Sci. U.S.A.</journal>
			<year>2017</year>
			<issue>47</issue>
			<volume>114</volume>
			<pages>12524-12529</pages>
			<abstract>During DNA replication, chromatin is disrupted ahead of the replication fork, and epigenetic information must be restored behind the fork. How epigenetic marks are inherited through DNA replication remains poorly understood. Histone H3 lysine 9 (H3K9) methylation and histone hypoacetylation are conserved hallmarks of heterochromatin. We previously showed that the inheritance of H3K9 methylation during DNA replication depends on the catalytic subunit of DNA polymerase epsilon, Cdc20. Here we show that the histone-fold subunit of Pol epsilon, Dpb4, interacts an uncharacterized small histone-fold protein, SPCC16C4.22, to form a heterodimer in fission yeast. We demonstrate that SPCC16C4.22 is nonessential for viability and corresponds to the true ortholog of Dpb3. We further show that the Dpb3-Dpb4 dimer associates with histone deacetylases, chromatin remodelers, and histones and plays a crucial role in the inheritance of histone hypoacetylation in heterochromatin. We solve the 1.9-Å crystal structure of Dpb3-Dpb4 and reveal that they form the H2A-H2B-like dimer. Disruption of Dpb3-Dpb4 dimerization results in loss of heterochromatin silencing. Our findings reveal a link between histone deacetylation and H3K9 methylation and suggest a mechanism for how two processes are coordinated during replication. We propose that the Dpb3-Dpb4 heterodimer together with Cdc20 serves as a platform for the recruitment of chromatin modifiers and remodelers that mediate heterochromatin assembly during DNA replication, and ensure the faithful inheritance of epigenetic marks in heterochromatin.</abstract>
		</publication>
	</general>
	<function>
		<molecular_function>
			<go>
				<accession>GO:0046982</accession>
				<name>protein heterodimerization activity</name>
			</go>
		</molecular_function>
		<cellular_component>
			<go>
				<accession>GO:0008622</accession>
				<name>epsilon DNA polymerase complex</name>
			</go>
			<go>
				<accession>GO:0043596</accession>
				<name>nuclear replication fork</name>
			</go>
			<go>
				<accession>GO:0005634</accession>
				<name>nucleus</name>
			</go>
		</cellular_component>
		<biological_process>
			<go>
				<accession>GO:0140529</accession>
				<name>CMG complex assembly</name>
			</go>
			<go>
				<accession>GO:1902983</accession>
				<name>DNA strand elongation involved in mitotic DNA replication</name>
			</go>
			<go>
				<accession>GO:0006261</accession>
				<name>DNA-templated DNA replication</name>
			</go>
			<go>
				<accession>GO:0031507</accession>
				<name>heterochromatin formation</name>
			</go>
		</biological_process>
	</function>
	<macromolecules>
		<general>
			<nr_of_chains>2</nr_of_chains>
			<nr_of_unique_protein_segments>2</nr_of_unique_protein_segments>
			<class>Histone-like interactions</class>
			<subclass>Histone-like complexes</subclass>
			<note>All chains according to the most probable oligomerization state stored in PDBe were considered.</note>
		</general>
		<chain>
			<id>A</id>
			<name>DNA polymerase epsilon subunit D</name>
			<source_organism>Schizosaccharomyces pombe</source_organism>
			<uniprot>
				<id>P87174</id>
				<start>9</start>
				<end>105</end>
				<coverage>46%</coverage>
				<sequence>MNQDKSKETSELDDLALPRSIIMRLVKGVLPEKSLVQKEALKAMINSATLFVSFLTSASGEIATNNNRKILMPQDVLNALDEIEYPEFSKTLKKHLEAYELALKEKRLKLPNVSDVDNRKKAKIDAHDTTPLDEEKDELEEERIAEDIAQNEVEQNIDDVEDLEEVNDTLDANAESPQIETIHLTDATGNPIEDSSESDSEESLQLNDSS</sequence>
				<length>210</length>
			</uniprot>
			<regions>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>10</region_start>
					<region_end>17</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>19</region_start>
					<region_end>29</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>38</region_start>
					<region_end>67</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>73</region_start>
					<region_end>84</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>86</region_start>
					<region_end>88</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>helix</region_name>
					<region_start>89</region_start>
					<region_end>105</region_end>
				</region>
				<region>
					<region_type>secondary structure</region_type>
					<region_name>strand</region_name>
					<region_start>71</region_start>
					<region_end>72</region_end>
				</region>
				<region>
					<region_type>pfam</region_type>
					<region_id>PF00808</region_id>
					<region_name>Histone-like transcription factor (CBF/NF-Y) and archaeal histone</region_name>
					<region_start>17</region_start>
					<region_end>80</region_end>
				</region>
			</regions>
		</chain>
		<chain>
			<id>B</id>
			<name>DNA polymerase epsilon subunit C</name>
			<source_organism>Schizosaccharomyces pombe</source_organism>
			<uniprot>
				<id>C6Y4D0</id>
				<start>1</start>
				<end>87</end>
				<coverage>100%</coverage>
				<sequence>MEKTYGKTVLPLSRVKRIIKQDEDVHYCSNASALLISVATELFVEKLATEAYQLAKLQKRKGIRYRDVEDVVRKDDQFEFLSDLFSI</sequence>
				<length>87</length>
			</uniprot>
			<regions>
				<region>
					<region_type>pfam</region_type>
					<region_id>PF00808</region_id>
					<region_name>Histone-like transcription factor (CBF/NF-Y) and archaeal histone</region_name>
					<region_start>10</region_start>
					<region_end>72</region_end>
				</region>
			</regions>
		</chain>
	</macromolecules>
	<evidence>
		<evidence_level>Direct evidence</evidence_level>
		<evidence_coverage>The full structure participates in mutual synergistic folding.</evidence_coverage>
		<sequence_domain>Histone-like transcription factor (CBF/NF-Y) and archaeal histone</sequence_domain>
		<complex_evidence>Data on the GdmCl-induced unfolding and refolding transitions of the dimer (monitored by stopped-flow far UV CD) fitted to a two-state model (PMID:15313621).</complex_evidence>
		<chain_evidence>
			<chain_id>A</chain_id>
			<support>N/A</support>
		</chain_evidence>
		<chain_evidence>
			<chain_id>B</chain_id>
			<support>N/A</support>
		</chain_evidence>
	</evidence>
	<related_structures>
		<id>MF2130001</id>
		<id>MF7000001</id>
		<id>MF7000002</id>
		<id>MF7000004</id>
		<id>MF7000005</id>
		<id>MF7000384</id>
		<id>MF7000385</id>
	</related_structures>
</entry>
