MF7000233 DR2232 (E46A mutant) 5hwu X-ray 2.10 Homodimer Deinococcus radiodurans 27739259 Mota CS, Gonçalves AM, de Sanctis D FEBS J. 2016 23 283 4274-4290 GO:0046872 metal ion binding GO:0047429 nucleoside triphosphate diphosphatase activity 2 1 Homooligomeric enzymes Homodimeric enzymes All chains according to the most probable oligomerization state stored in PDBe were considered. A HAD superfamily Cof-like phosphohydrolase Deinococcus radiodurans Q9RS96 7 144 93% MSDLPCPPTNAERLHEFHRAIGAATPERPTPPPPELLRLRQTLLDEESAEVRAEIDHLLARQAAGEALSAGDLAPLAHELADLLYVTYGALDQLGIDADAVFAEVHRANLSKASGPRRADGKQLKPEGWRPADVRGVIERLQHAPADD 148 secondary structure helix 3 15 secondary structure helix 27 58 secondary structure helix 64 66 secondary structure helix 67 88 secondary structure helix 91 105 secondary structure helix 127 137 pfam PF01503 Phosphoribosyl-ATP pyrophosphohydrolase 14 109 B HAD superfamily Cof-like phosphohydrolase Deinococcus radiodurans Q9RS96 7 144 93% MSDLPCPPTNAERLHEFHRAIGAATPERPTPPPPELLRLRQTLLDEESAEVRAEIDHLLARQAAGEALSAGDLAPLAHELADLLYVTYGALDQLGIDADAVFAEVHRANLSKASGPRRADGKQLKPEGWRPADVRGVIERLQHAPADD 148 secondary structure helix 3 15 secondary structure helix 27 58 secondary structure helix 64 66 secondary structure helix 67 88 secondary structure helix 91 107 secondary structure helix 127 137 pfam PF01503 Phosphoribosyl-ATP pyrophosphohydrolase 14 109 Direct evidence The full structure participates in mutual synergistic folding. Phosphoribosyl-ATP pyrophosphohydrolase Phosphoribosyl-ATP pyrophosphohydrolases show a very unusual interlaced segment-swapped dimer, which implies that this obligatory dimer assembly is important for their function. Size-exclusion chromatography combined with static light scattering confirmed that the dimer is the major oligomeric state in solution (PMID:20944217). Upon dimer formation, DR2231 helices 2 and 3 from one monomer stack antiparallel to helices 2′ and 3′ of the other monomer, respectively. A stable four-helix bundle is formed in the center. The intertwining of the two hairpin structures produces an extensive subunit-subunit interface (PMID:21733847). A N/A B N/A MF7000284 MF7000232 MF7000233