{"entry": {"accession": "MF7000913", "general": {"name": "Bi-functional enzyme", "pdb_id": "6j2l", "exp_method": "X-ray", "resolution": "2.17", "assembly": "Homodimer", "source_organism": "Shigella flexneri", "publication": {"pmid": "31235255", "authors": "Wang Y, Zhang F, Nie Y, Shang G, Zhang H", "title": "Structural analysis of Shigella flexneri bi-functional enzyme HisIE in histidine biosynthesis.", "journal": "Biochem. Biophys. Res. Commun.", "year": "2019", "issue": "2", "volume": "516", "pages": "540-545", "abstract": "Histidine biosynthesis, which is absent in animals, was shown to be highly conserved among gram-negative bacteria, thus making it an attractive target for antibiotic design. There are many fusion forms of enzymes in the histidine biosynthetic pathway and people still have limited knowledge about their domain organizations and catalytic mechanisms, due to the lack of structural information. Here we report the first crystal structure of Shigella flexneri bi-functional enzyme HisIE (SfHisIE) that functions in the 2nd and 3rd steps in the histidine biosynthetic pathway. This structure shows that HisIE exists as dimers with two loops (fusion loop) connecting the individual dimer of HisE and HisI in its N-terminus and C-terminus respectively. Our mutagenesis study shows mutations in this fusion loop are lethal for bacteria indicating the advantage of gene fusion in Histidine biosynthesis. Structural analysis revealed several highly conserved residues in the putative ligand binding grooves of HisE and HisI, showing an evolutionarily conserved catalytic mechanism shared among gram negative-bacteria."}}, "function": {"molecular_function": {"go": [{"accession": "GO:0005524", "name": "ATP binding"}, {"accession": "GO:0004635", "name": "phosphoribosyl-AMP cyclohydrolase activity"}, {"accession": "GO:0004636", "name": "phosphoribosyl-ATP diphosphatase activity"}]}, "cellular_component": {"go": {"accession": "GO:0005737", "name": "cytoplasm"}}, "biological_process": {"go": [{"accession": "GO:0008652", "name": "amino acid biosynthetic process"}, {"accession": "GO:0000105", "name": "histidine biosynthetic process"}]}}, "macromolecules": {"general": {"nr_of_chains": "2", "nr_of_unique_protein_segments": "1", "class": "Homooligomeric enzymes", "subclass": "Homodimeric enzymes", "note": "All chains according to the most probable oligomerization state stored in PDBe were considered."}, "chain": [{"id": "A", "name": "Histidine biosynthesis bifunctional protein HisIE", "source_organism": "Shigella flexneri", "uniprot": {"id": "P37793", "start": "2", "end": "201", "coverage": "98%", "sequence": "MLTEQQRRELDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTIESGKVTFFSRTKQRLWIKGETSGNFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCFGNTAHQWLFLYQLEQLLAERKYADPETSYTAKLYASGTKRIAQKVGEEGVETALAATVHDRFELTNEASDLMYHLLVLLQDQDLDLTTVIENLHKRHQ", "length": "203"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "2", "region_end": "9"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "37", "region_end": "48"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "111", "region_end": "124"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "132", "region_end": "141"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "141", "region_end": "162"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "164", "region_end": "186"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "189", "region_end": "200"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "18", "region_end": "24"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "30", "region_end": "36"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "51", "region_end": "54"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "59", "region_end": "62"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "70", "region_end": "78"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "85", "region_end": "92"}, {"region_type": "pfam", "region_id": "PF01503", "region_name": "Phosphoribosyl-ATP pyrophosphohydrolase", "region_start": "115", "region_end": "202"}]}}, {"id": "B", "name": "Histidine biosynthesis bifunctional protein HisIE", "source_organism": "Shigella flexneri", "uniprot": {"id": "P37793", "start": "3", "end": "201", "coverage": "98%", "sequence": "MLTEQQRRELDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTIESGKVTFFSRTKQRLWIKGETSGNFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCFGNTAHQWLFLYQLEQLLAERKYADPETSYTAKLYASGTKRIAQKVGEEGVETALAATVHDRFELTNEASDLMYHLLVLLQDQDLDLTTVIENLHKRHQ", "length": "203"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "2", "region_end": "8"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "37", "region_end": "48"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "111", "region_end": "124"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "125", "region_end": "127"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "137", "region_end": "140"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "141", "region_end": "163"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "164", "region_end": "186"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "189", "region_end": "200"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "18", "region_end": "24"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "30", "region_end": "36"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "51", "region_end": "53"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "60", "region_end": "62"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "70", "region_end": "78"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "85", "region_end": "92"}, {"region_type": "pfam", "region_id": "PF01503", "region_name": "Phosphoribosyl-ATP pyrophosphohydrolase", "region_start": "115", "region_end": "202"}]}}]}, "evidence": {"evidence_level": "Indirect evidence", "evidence_coverage": "The full structure participates in mutual synergistic folding.", "sequence_domain": "Histidine biosynthesis bifunctional protein", "complex_evidence": "HisIE and MtHISN2 are proteins with with discrete and directly interacting pyrophosphohydrolase and cyclohydrolase domains. They form a tight dimer with large buried interface. The dimer is formed by two mutually swapped polypeptide chains, forming a bilobial protein. The existence of a monomeric form of either PRA-PH or PRA-CH domain is highly improbable. The dimeric form is consistent with the size-exclusion elution profile. In case of HisIE dimerization is very important for catalytic activity, since its catalytic pocket is formed by both protomers. Arg201 from one monomer is required to stabilize helix 4 in the other monomer, thus making it suitable for substrate binding (PMID:31235255, PMID:33958623).", "chain_evidence": [{"chain_id": "A", "support": "N/A"}, {"chain_id": "B", "support": "N/A"}]}, "related_structures": {"id": ["MF7000912", "MF7000913", "MF7000914"]}}}