{"entry": {"accession": "MF7000856", "general": {"name": "Beta-carbonic anhydrase isoform I (TvaCA1) (Trichomonas vaginalis protozoan)", "pdb_id": "6y04", "exp_method": "X-ray", "resolution": "2.48", "assembly": "Homodimer", "source_organism": "Trichomonas vaginalis", "publication": {"pmid": "32515610", "authors": "Urba\u0144ski LJ, Di Fiore A, Azizi L, Hyt\u00f6nen VP, Kuuslahti M, Buonanno M, Monti SM, Angeli A, Zolfaghari Emameh R, Supuran CT, De Simone G, Parkkila S", "title": {"i": "Trichomonas vaginalis", "#text": "Biochemical and structural characterisation of a protozoan beta-carbonic anhydrase from ."}, "journal": "J Enzyme Inhib Med Chem", "year": "2020", "issue": "1", "volume": "35", "pages": "1292-1299", "abstract": "We report the biochemical and structural characterisation of a beta-carbonic anhydrase (\u03b2-CA) from <i>Trichomonas vaginalis</i>, a unicellular parasite responsible for one of the world's leading sexually transmitted infections, trichomoniasis. CAs are ubiquitous metalloenzymes belonging to eight evolutionarily divergent groups (\u03b1, \u03b2, \u03b3, \u03b4, \u03b6, \u03b7, \u03b8, and \u03b9); humans express only \u03b1-CAs, whereas many clinically significant pathogens express only \u03b2- and/or \u03b3-CAs. For this reason, the latter two groups of CAs are promising biomedical targets for novel antiinfective agents. The \u03b2-CA from <i>T. vaginalis</i> (TvaCA1) was recombinantly produced and biochemically characterised. The crystal structure was determined, revealing the canonical dimeric fold of \u03b2-CAs and the main features of the enzyme active site. The comparison with the active site of human CA enzymes revealed significant differences that can be exploited for the design of inhibitors selective for the protozoan enzyme with respect to the human ones."}}, "function": {"molecular_function": {"go": [{"accession": "GO:0004089", "name": "carbonate dehydratase activity"}, {"accession": "GO:0008270", "name": "zinc ion binding"}]}}, "macromolecules": {"general": {"nr_of_chains": "2", "nr_of_unique_protein_segments": "1", "class": "Homooligomeric enzymes", "subclass": "Homodimeric enzymes", "note": "All chains according to the most probable oligomerization state stored in PDBe were considered."}, "chain": [{"id": "A", "name": "Carbonic anhydrase", "source_organism": "Trichomonas vaginalis", "uniprot": {"id": "A2ENQ8", "start": "1", "end": "182", "coverage": "100%", "sequence": "MSQLELITSANQAFLEANPELTKLNKAPQRHIAIVTCMDTRLVNFAEDAIGVKRGEATVIKAAGNGIWTTGLSDIVVSLLVSIYELGVQEIFIMGHECCGMTHASTDSLGAQMLKSGIKPEDIEKFKSDLSKWVDDFKDPIDNIKNSVRCVRENPLIPKNIPIHGLLIHPDTGKVTTIINGY", "length": "182"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "2", "region_end": "18"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "39", "region_end": "43"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "45", "region_end": "50"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "73", "region_end": "85"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "105", "region_end": "116"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "119", "region_end": "135"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "139", "region_end": "153"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "32", "region_end": "36"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "57", "region_end": "61"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "90", "region_end": "96"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "163", "region_end": "168"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "175", "region_end": "179"}, {"region_type": "pfam", "region_id": "PF00484", "region_name": "Carbonic anhydrase", "region_start": "33", "region_end": "175"}]}}, {"id": "B", "name": "Carbonic anhydrase", "source_organism": "Trichomonas vaginalis", "uniprot": {"id": "A2ENQ8", "start": "1", "end": "182", "coverage": "100%", "sequence": "MSQLELITSANQAFLEANPELTKLNKAPQRHIAIVTCMDTRLVNFAEDAIGVKRGEATVIKAAGNGIWTTGLSDIVVSLLVSIYELGVQEIFIMGHECCGMTHASTDSLGAQMLKSGIKPEDIEKFKSDLSKWVDDFKDPIDNIKNSVRCVRENPLIPKNIPIHGLLIHPDTGKVTTIINGY", "length": "182"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "2", "region_end": "18"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "39", "region_end": "43"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "45", "region_end": "50"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "73", "region_end": "85"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "105", "region_end": "116"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "119", "region_end": "135"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "139", "region_end": "153"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "32", "region_end": "36"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "57", "region_end": "61"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "90", "region_end": "96"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "163", "region_end": "168"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "175", "region_end": "179"}, {"region_type": "pfam", "region_id": "PF00484", "region_name": "Carbonic anhydrase", "region_start": "33", "region_end": "175"}]}}]}, "evidence": {"evidence_level": "Indirect evidence", "evidence_coverage": "The full structure participates in mutual synergistic folding.", "sequence_domain": "Carbonic anhydrase", "complex_evidence": "The native carbonic anhydrase is dimeric in solution, in agreement with being a tightly associated dimer with a large, hydrophobic buried surface area. The extended \u03b2-sheet core consisting of ten \u03b2\u2013strands is equally contributed by the two monomers, and the N-terminal helix of each monomer extends around the other monomer. Based on the highly intertwined structure, the monomeric form is most probably not a stable, independently folding unit. The two active sites are also located in clefts at the dimeric interface, further suggesting that dimer is the functional form (PMID:32515610).", "chain_evidence": [{"chain_id": "A", "support": "N/A"}, {"chain_id": "B", "support": "N/A"}]}, "related_structures": {"id": ["MF7000278", "MF7000279", "MF7000856", "MF7000857", "MF7000858", "MF7000859"]}}}