{"entry": {"accession": "MF7000840", "general": {"name": "Peroxide resistance protein (Xylella fastidiosa)", "pdb_id": "1zb8", "exp_method": "X-ray", "resolution": "2.40", "assembly": "Homodimer", "source_organism": "Xylella fastidiosa", "publication": {"pmid": "16631787", "authors": "Oliveira MA, Guimar\u00e3es BG, Cussiol JR, Medrano FJ, Gozzo FC, Netto LE", "title": "Structural insights into enzyme-substrate interaction and characterization of enzymatic intermediates of organic hydroperoxide resistance protein from Xylella fastidiosa.", "journal": "J. Mol. Biol.", "year": "2006", "issue": "2", "volume": "359", "pages": "433-45", "abstract": "Organic hydroperoxide resistance proteins (Ohr) belong to a family of proteins that possess thiol-dependent peroxidase activity endowed by reactive cysteine residues able to reduce peroxides. The crystal structure of Ohr from Xylella fastidiosa in complex with polyethylene glycol, providing insights into enzyme-substrate interactions is described herein. In addition, crystallographic studies, molecular modeling and biochemical assays also indicated that peroxides derived from long chain fatty acids could be the biological substrates of Ohr. Because different oxidation states of the reactive cysteine were present in the Ohr structures from X. fastidiosa, Pseudomonas aeruginosa and Deinococcus radiodurans it was possible to envisage a set of snapshots along the coordinate of the enzyme-catalyzed reaction. The redox intermediates of X. fastidiosa Ohr observed in the crystals were further characterized in solution by electrospray ionization mass spectrometry and by biochemical approaches. In this study, the formation of an intramolecular disulfide bond and oxidative inactivation through the formation of a sulfonic acid derivative was unequivocally demonstrated for the first time. Because Ohr proteins are exclusively present in bacteria, they may represent promising targets for therapeutical drugs. In this regard, the structural and functional analyses of Ohr presented here might be very useful."}}, "function": {"biological_process": {"go": {"accession": "GO:0006979", "name": "response to oxidative stress"}}}, "macromolecules": {"general": {"nr_of_chains": "2", "nr_of_unique_protein_segments": "1", "class": "Homooligomeric enzymes", "subclass": "Homodimeric enzymes", "note": "All chains according to the most probable oligomerization state stored in PDBe were considered."}, "chain": [{"id": "A", "name": "Organic hydroperoxide resistance protein", "source_organism": "Xylella fastidiosa", "uniprot": {"id": "Q9PCF4", "start": "3", "end": "143", "coverage": "98%", "sequence": "MNSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSACFIGALKFVANKEKVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILID", "length": "143"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "37", "region_end": "41"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "49", "region_end": "73"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "110", "region_end": "125"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "125", "region_end": "132"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "9", "region_end": "16"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "21", "region_end": "25"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "31", "region_end": "34"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "82", "region_end": "92"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "95", "region_end": "105"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "137", "region_end": "141"}, {"region_type": "pfam", "region_id": "PF02566", "region_name": "OsmC-like protein", "region_start": "44", "region_end": "137"}]}}, {"id": "B", "name": "Organic hydroperoxide resistance protein", "source_organism": "Xylella fastidiosa", "uniprot": {"id": "Q9PCF4", "start": "3", "end": "143", "coverage": "98%", "sequence": "MNSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSACFIGALKFVANKEKVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILID", "length": "143"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "37", "region_end": "41"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "49", "region_end": "73"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "110", "region_end": "125"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "125", "region_end": "132"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "9", "region_end": "16"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "22", "region_end": "25"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "31", "region_end": "33"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "82", "region_end": "92"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "95", "region_end": "105"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "137", "region_end": "142"}, {"region_type": "pfam", "region_id": "PF02566", "region_name": "OsmC-like protein", "region_start": "44", "region_end": "137"}]}}]}, "evidence": {"evidence_level": "Direct evidence", "evidence_coverage": "The full structure participates in mutual synergistic folding.", "sequence_domain": "OsmC-like protein", "complex_evidence": "Ohr is a tightly folded homodimer with a large buried hydrophobic surface area. The two monomers are tightly wrapped around each other in a head-to-tail orientation. Dimerization is dominated by helix\u2013helix packing interactions of two long helices at the center of the hydrophobic core of the dimeric enzyme. Also, each \u03b2-sheet is composed of six strands, three from one monomer and three from the other (beta sheet augmentation). The hydrophobic core, as well as the surrounding \u03b2-sheets, are generated by combining elements of both monomers, therefore, it is clear that the two polypeptide chains have to fold together to form active Ohr, and that each monomer would individually be unstable. The two active sites are also located at the dimer interface (PMID:12485986).", "chain_evidence": [{"chain_id": "A", "support": "N/A"}, {"chain_id": "B", "support": "N/A"}]}, "related_structures": {"id": ["MF7000837", "MF7000838", "MF7000839", "MF7000840", "MF7000841", "MF7000842", "MF7000843"]}}}