{"entry": {"accession": "MF7000724", "general": {"name": "TrmD, a tRNA-(N1G37) methyltransferase (Mycobacterium abscessus)", "pdb_id": "6qqw", "exp_method": "X-ray", "resolution": "1.80", "assembly": "Homodimer", "source_organism": "Mycobacteroides abscessus", "publication": {"pmid": "31282680", "authors": "Whitehouse AJ, Thomas SE, Brown KP, Fanourakis A, Chan DS, Libardo MDJ, Mendes V, Boshoff HIM, Floto RA, Abell C, Blundell TL, Coyne AG", "title": {"i": "Mycobacterium abscessus", "sub": "1", "#text": "Development of Inhibitors against  tRNA (mG37) Methyltransferase (TrmD) Using Fragment-Based Approaches."}, "journal": "J. Med. Chem.", "year": "2019", "issue": "15", "volume": "62", "pages": "7210-7232", "abstract": "<i>Mycobacterium abscessus</i> (<i>Mab</i>) is a rapidly growing species of multidrug-resistant nontuberculous mycobacteria that has emerged as a growing threat to individuals with cystic fibrosis and other pre-existing chronic lung diseases. <i>Mab</i> pulmonary infections are difficult, or sometimes impossible, to treat and result in accelerated lung function decline and premature death. There is therefore an urgent need to develop novel antibiotics with improved efficacy. tRNA (m<sub>1</sub>G37) methyltransferase (TrmD) is a promising target for novel antibiotics. It is essential in <i>Mab</i> and other mycobacteria, improving reading frame maintenance on the ribosome to prevent frameshift errors. In this work, a fragment-based approach was employed with the merging of two fragments bound to the active site, followed by structure-guided elaboration to design potent nanomolar inhibitors against <i>Mab</i> TrmD. Several of these compounds exhibit promising activity against mycobacterial species, including <i>Mycobacterium tuberculosis</i> and <i>Mycobacterium leprae</i> in addition to <i>Mab</i>, supporting the use of TrmD as a target for the development of antimycobacterial compounds."}}, "function": {"molecular_function": {"go": {"accession": "GO:0052906", "name": "tRNA (guanine(37)-N1)-methyltransferase activity"}}, "cellular_component": {"go": {"accession": "GO:0005829", "name": "cytosol"}}, "biological_process": {"go": {"accession": "GO:0002939", "name": "tRNA N1-guanine methylation"}}}, "macromolecules": {"general": {"nr_of_chains": "2", "nr_of_unique_protein_segments": "1", "class": "Homooligomeric enzymes", "subclass": "Homodimeric enzymes", "note": "All chains according to the most probable oligomerization state stored in PDBe were considered."}, "chain": [{"id": "A", "name": "tRNA (guanine-N(1)-)-methyltransferase", "source_organism": "Mycobacteroides abscessus", "uniprot": {"id": "B1MDI3", "start": "1", "end": "227", "coverage": "93%", "sequence": "MKIDVVTIFPEYLQPVRQSLPGKAIDAGLVDVAVHDLRRWTHDVHKSVDDSPYGGGPGMVMKPTVWGDALDEICTSETLLVVPTPAGYPFTQETAWQWSTEDHLVIACGRYEGIDQRVADDAATRMRVREVSIGDYVLNGGEAAALVIIEAVLRLVPGVLGNALSAQEDSHSEGMASLLEGPSYTRPPSWRGMDVPPVLLSGDHAKIAAWRAEQSRQRTIERRPDLLGFDSPTGEHGGDGLS", "length": "242"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "11", "region_end": "14"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "15", "region_end": "22"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "23", "region_end": "29"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "40", "region_end": "43"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "64", "region_end": "76"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "93", "region_end": "101"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "118", "region_end": "125"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "143", "region_end": "156"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "198", "region_end": "203"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "205", "region_end": "225"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "226", "region_end": "229"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "3", "region_end": "9"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "32", "region_end": "38"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "51", "region_end": "52"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "62", "region_end": "63"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "81", "region_end": "85"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "90", "region_end": "91"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "105", "region_end": "109"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "129", "region_end": "134"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "191", "region_end": "192"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "195", "region_end": "196"}, {"region_type": "pfam", "region_id": "PF01746", "region_name": "tRNA (Guanine-1)-methyltransferase", "region_start": "22", "region_end": "224"}]}}, {"id": "B", "name": "tRNA (guanine-N(1)-)-methyltransferase", "source_organism": "Mycobacteroides abscessus", "uniprot": {"id": "B1MDI3", "start": "1", "end": "232", "coverage": "95%", "sequence": "MKIDVVTIFPEYLQPVRQSLPGKAIDAGLVDVAVHDLRRWTHDVHKSVDDSPYGGGPGMVMKPTVWGDALDEICTSETLLVVPTPAGYPFTQETAWQWSTEDHLVIACGRYEGIDQRVADDAATRMRVREVSIGDYVLNGGEAAALVIIEAVLRLVPGVLGNALSAQEDSHSEGMASLLEGPSYTRPPSWRGMDVPPVLLSGDHAKIAAWRAEQSRQRTIERRPDLLGFDSPTGEHGGDGLS", "length": "242"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "11", "region_end": "16"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "40", "region_end": "43"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "64", "region_end": "76"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "93", "region_end": "101"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "118", "region_end": "126"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "143", "region_end": "156"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "199", "region_end": "204"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "205", "region_end": "225"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "226", "region_end": "230"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "3", "region_end": "9"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "32", "region_end": "38"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "51", "region_end": "52"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "62", "region_end": "63"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "81", "region_end": "85"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "90", "region_end": "91"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "105", "region_end": "109"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "129", "region_end": "134"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "191", "region_end": "192"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "195", "region_end": "196"}, {"region_type": "pfam", "region_id": "PF01746", "region_name": "tRNA (Guanine-1)-methyltransferase", "region_start": "22", "region_end": "224"}]}}]}, "evidence": {"evidence_level": "Indirect evidence", "evidence_coverage": "The full structure participates in mutual synergistic folding.", "sequence_domain": "tRNA (Guanine-1)-methyltransferase", "complex_evidence": "Multisubdomain structure, where both subdomains participate in dimerization. The C-terminal domain is TRP repressor-like. The structure suggests that the dimer is the functional form of the protein since it has an extensive and tight hydrophobic interface and a large buried surface area. DLS data of the protein solution suggest that the A. aeolicus tRNA (m1G37) methyltransferase is oligomeric (dimer or trimer) in solution (PMID:12773376). The active site is also located at the subunit interface (PMID:14517984).", "chain_evidence": [{"chain_id": "A", "support": "N/A"}, {"chain_id": "B", "support": "N/A"}]}, "related_structures": {"id": ["MF7000723", "MF7000724", "MF7000725", "MF7000726", "MF7000727", "MF7000728", "MF7000729", "MF7000730", "MF7000731", "MF7000732", "MF7000733", "MF7000734", "MF7000735", "MF7000736", "MF7000737", "MF7000738"]}}}