{"entry": {"accession": "MF7000227", "general": {"name": "SurE (Coxiella burnetii)", "pdb_id": "3ty2", "exp_method": "X-ray", "resolution": "1.89", "assembly": "Homodimer", "source_organism": "Coxiella burnetii", "publication": {"pmid": "26033498", "authors": "Franklin MC, Cheung J, Rudolph MJ, Burshteyn F, Cassidy M, Gary E, Hillerich B, Yao ZK, Carlier PR, Totrov M, Love JD", "title": "Structural genomics for drug design against the pathogen Coxiella burnetii.", "journal": "Proteins", "year": "2015", "issue": "12", "volume": "83", "pages": "2124-36", "abstract": "Coxiella burnetii is a highly infectious bacterium and potential agent of bioterrorism. However, it has not been studied as extensively as other biological agents, and very few of its proteins have been structurally characterized. To address this situation, we undertook a study of critical metabolic enzymes in C. burnetii that have great potential as drug targets. We used high-throughput techniques to produce novel crystal structures of 48 of these proteins. We selected one protein, C. burnetii dihydrofolate reductase (CbDHFR), for additional work to demonstrate the value of these structures for structure-based drug design. This enzyme's structure reveals a feature in the substrate binding groove that is different between CbDHFR and human dihydrofolate reductase (hDHFR). We then identified a compound by in silico screening that exploits this binding groove difference, and demonstrated that this compound inhibits CbDHFR with at least 25-fold greater potency than hDHFR. Since this binding groove feature is shared by many other prokaryotes, the compound identified could form the basis of a novel antibacterial agent effective against a broad spectrum of pathogenic bacteria."}}, "function": {"molecular_function": {"go": [{"accession": "GO:0008254", "name": "3'-nucleotidase activity"}, {"accession": "GO:0008253", "name": "5'-nucleotidase activity"}, {"accession": "GO:0004309", "name": "exopolyphosphatase activity"}, {"accession": "GO:0046872", "name": "metal ion binding"}, {"accession": "GO:0000166", "name": "nucleotide binding"}, {"accession": "GO:0106411", "name": "XMP 5'-nucleosidase activity"}]}, "cellular_component": {"go": {"accession": "GO:0005737", "name": "cytoplasm"}}}, "macromolecules": {"general": {"nr_of_chains": "2", "nr_of_unique_protein_segments": "1", "class": "Homooligomeric enzymes", "subclass": "Homodimeric enzymes", "note": "All chains according to the most probable oligomerization state stored in PDBe were considered."}, "chain": [{"id": "A", "name": "5'-nucleotidase SurE", "source_organism": "Coxiella burnetii", "uniprot": {"id": "Q9KI21", "start": "8", "end": "258", "coverage": "97%", "sequence": "MKKTATPKLRLLLSNDDGVYAKGLAILAKTLADLGEVDVVAPDRNRSGASNSLTLNAPLHIKNLENGMISVEGTPTDCVHLAITGVLPEMPDMVVAGINAGPNLGDDVWYSGTVAAAMEGRFLGLPALAVSLGGELFRYYETAAKVVYQLIQRIEKDPLPPSTILNINVPDLPYEELKGFEVTRLGTRHRAEPTIRQIDPRGHPIYWVGAAGPEQDSGPGTDFFAMNHHCVSITPLRVDLTHYEAFDQLASWVKRLEM", "length": "258"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "24", "region_end": "35"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "77", "region_end": "86"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "107", "region_end": "113"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "114", "region_end": "123"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "142", "region_end": "160"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "176", "region_end": "180"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "224", "region_end": "231"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "245", "region_end": "247"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "248", "region_end": "260"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "13", "region_end": "17"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "39", "region_end": "45"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "62", "region_end": "66"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "72", "region_end": "74"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "96", "region_end": "103"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "130", "region_end": "135"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "167", "region_end": "172"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "182", "region_end": "185"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "198", "region_end": "201"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "207", "region_end": "210"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "233", "region_end": "238"}, {"region_type": "pfam", "region_id": "PF01975", "region_name": "Survival protein SurE", "region_start": "12", "region_end": "190"}]}}, {"id": "B", "name": "5'-nucleotidase SurE", "source_organism": "Coxiella burnetii", "uniprot": {"id": "Q9KI21", "start": "8", "end": "258", "coverage": "97%", "sequence": "MKKTATPKLRLLLSNDDGVYAKGLAILAKTLADLGEVDVVAPDRNRSGASNSLTLNAPLHIKNLENGMISVEGTPTDCVHLAITGVLPEMPDMVVAGINAGPNLGDDVWYSGTVAAAMEGRFLGLPALAVSLGGELFRYYETAAKVVYQLIQRIEKDPLPPSTILNINVPDLPYEELKGFEVTRLGTRHRAEPTIRQIDPRGHPIYWVGAAGPEQDSGPGTDFFAMNHHCVSITPLRVDLTHYEAFDQLASWVKRLEM", "length": "258"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "24", "region_end": "35"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "77", "region_end": "86"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "107", "region_end": "113"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "114", "region_end": "123"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "124", "region_end": "126"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "142", "region_end": "160"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "176", "region_end": "180"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "224", "region_end": "231"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "245", "region_end": "247"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "248", "region_end": "258"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "259", "region_end": "261"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "13", "region_end": "17"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "39", "region_end": "45"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "62", "region_end": "66"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "72", "region_end": "74"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "96", "region_end": "103"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "130", "region_end": "135"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "167", "region_end": "172"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "183", "region_end": "185"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "198", "region_end": "201"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "207", "region_end": "210"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "234", "region_end": "239"}, {"region_type": "pfam", "region_id": "PF01975", "region_name": "Survival protein SurE", "region_start": "12", "region_end": "190"}]}}]}, "evidence": {"evidence_level": "Direct evidence", "evidence_coverage": "The full structure participates in mutual synergistic folding.", "sequence_domain": "Survival protein SurE", "complex_evidence": "Two-state thermal unfolding (PMID:23409101). Domain-swapped dimer with extensive swap region and large dimer interface. Dimeric in solution (gel filtration, DLS).", "chain_evidence": [{"chain_id": "A", "support": "N/A"}, {"chain_id": "B", "support": "N/A"}]}, "related_structures": {"id": ["MF7000821", "MF7000221", "MF7000222", "MF7000224", "MF7000227", "MF7000223", "MF7000225", "MF7000226"]}}}