{"entry": {"accession": "MF7000201", "general": {"name": "UPF0066 protein AF0241", "pdb_id": "2nv4", "exp_method": "X-ray", "resolution": "2.20", "assembly": "Homodimer", "source_organism": "Archaeoglobus fulgidus", "publication": {"pmid": "17588214", "authors": "Forouhar F, Kuzin A, Seetharaman J, Lee I, Zhou W, Abashidze M, Chen Y, Yong W, Janjua H, Fang Y, Wang D, Cunningham K, Xiao R, Acton TB, Pichersky E, Klessig DF, Porter CW, Montelione GT, Tong L", "title": "Functional insights from structural genomics.", "journal": "J. Struct. Funct. Genomics", "year": "2007", "issue": "2-3", "volume": "8", "pages": "37-44", "abstract": "Structural genomics efforts have produced structural information, either directly or by modeling, for thousands of proteins over the past few years. While many of these proteins have known functions, a large percentage of them have not been characterized at the functional level. The structural information has provided valuable functional insights on some of these proteins, through careful structural analyses, serendipity, and structure-guided functional screening. Some of the success stories based on structures solved at the Northeast Structural Genomics Consortium (NESG) are reported here. These include a novel methyl salicylate esterase with important role in plant innate immunity, a novel RNA methyltransferase (H. influenzae yggJ (HI0303)), a novel spermidine/spermine N-acetyltransferase (B. subtilis PaiA), a novel methyltransferase or AdoMet binding protein (A. fulgidus AF_0241), an ATP:cob(I)alamin adenosyltransferase (B. subtilis YvqK), a novel carboxysome pore (E. coli EutN), a proline racemase homolog with a disrupted active site (B. melitensis BME11586), an FMN-dependent enzyme (S. pneumoniae SP_1951), and a 12-stranded beta-barrel with a novel fold (V. parahaemolyticus VPA1032)."}}, "function": {"molecular_function": {"go": {"accession": "GO:0089715", "name": "tRNA (L-threonylcarbamoyladenosine(37)-C2) methyltransferase activity"}}}, "macromolecules": {"general": {"nr_of_chains": "2", "nr_of_unique_protein_segments": "1", "class": "Homooligomeric enzymes", "subclass": "Homodimeric enzymes", "note": "All chains according to the most probable oligomerization state stored in PDBe were considered."}, "chain": [{"id": "A", "name": "S-adenosyl-L-methionine-binding protein AF_0241", "source_organism": "Archaeoglobus fulgidus", "uniprot": {"id": "O29998", "start": "1", "end": "133", "coverage": "95%", "sequence": "MILKPIGVVKSPFKTQNDAPRQGRFSDAVSEIAIFDEYADGLHKIENLRHIIVLYWMDKASRDKLRVVPPGETEERGVFTTRSPSRPNPIGLCVVEILEVERNRLKVRWLDALDGSPVIDIKKYSPEIDCVNQLEGQQP", "length": "139"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "22", "region_end": "26"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "35", "region_end": "40"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "41", "region_end": "43"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "44", "region_end": "48"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "79", "region_end": "81"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "125", "region_end": "130"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "7", "region_end": "10"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "29", "region_end": "34"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "50", "region_end": "56"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "66", "region_end": "67"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "76", "region_end": "77"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "90", "region_end": "101"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "104", "region_end": "108"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "117", "region_end": "123"}, {"region_type": "pfam", "region_id": "PF01980", "region_name": "tRNA-methyltransferase O", "region_start": "18", "region_end": "129"}]}}, {"id": "B", "name": "S-adenosyl-L-methionine-binding protein AF_0241", "source_organism": "Archaeoglobus fulgidus", "uniprot": {"id": "O29998", "start": "1", "end": "133", "coverage": "95%", "sequence": "MILKPIGVVKSPFKTQNDAPRQGRFSDAVSEIAIFDEYADGLHKIENLRHIIVLYWMDKASRDKLRVVPPGETEERGVFTTRSPSRPNPIGLCVVEILEVERNRLKVRWLDALDGSPVIDIKKYSPEIDCVNQLEGQQP", "length": "139"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "22", "region_end": "26"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "36", "region_end": "43"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "44", "region_end": "48"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "79", "region_end": "81"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "125", "region_end": "130"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "7", "region_end": "10"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "29", "region_end": "34"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "50", "region_end": "56"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "66", "region_end": "67"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "76", "region_end": "77"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "90", "region_end": "100"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "104", "region_end": "108"}, {"region_type": "secondary structure", "region_name": "strand", "region_start": "117", "region_end": "123"}, {"region_type": "pfam", "region_id": "PF01980", "region_name": "tRNA-methyltransferase O", "region_start": "18", "region_end": "129"}]}}]}, "evidence": {"evidence_level": "Insufficient evidence (candidate)", "evidence_coverage": "The full structure participates in mutual synergistic folding.", "sequence_domain": "-", "complex_evidence": "There is no information on the stability/disorder of the monomeric forms. AF_0241 is a dimer, both in solution and in the crystal (PMID:17588214).", "chain_evidence": [{"chain_id": "A", "support": "N/A"}, {"chain_id": "B", "support": "N/A"}]}}}