{"entry": {"accession": "MF7000162", "general": {"name": "Isochorismate-pyruvate lyase (Pseudomonas aeruginosa)", "pdb_id": "2h9c", "exp_method": "X-ray", "resolution": "2.35", "assembly": "Homodimer", "source_organism": "Pseudomonas aeruginosa", "publication": {"pmid": "16914555", "authors": "Zaitseva J, Lu J, Olechoski KL, Lamb AL", "title": "Two crystal structures of the isochorismate pyruvate lyase from Pseudomonas aeruginosa.", "journal": "J. Biol. Chem.", "year": "2006", "issue": "44", "volume": "281", "pages": "33441-9", "abstract": "Enzymatic systems that exploit pericyclic reaction mechanisms are rare. A recent addition to this class is the enzyme PchB, an 11.4-kDa isochorismate pyruvate lyase from Pseudomonas aeruginosa. The apo and pyruvate-bound structures of PchB reveal that the enzyme is a structural homologue of chorismate mutases in the AroQalpha class despite low sequence identity (20%). The enzyme is an intertwined dimer of three helices with connecting loops, and amino acids from each monomer participate in each of two active sites. The apo structure (2.35 A resolution) has one dimer per asymmetric unit with nitrate bound in an open active site. The loop between the first and second helices is disordered, providing a gateway for substrate entry and product exit. The pyruvate-bound structure (1.95 A resolution) has two dimers per asymmetric unit. One has two open active sites like the apo structure, and the other has two closed active sites with the loop between the first and second helices ordered for catalysis. Determining the structure of PchB is part of a larger effort to elucidate protein structures involved in siderophore biosynthesis, as these enzymes are crucial for bacterial iron uptake and virulence and have been identified as antimicrobial drug targets."}}, "function": {"molecular_function": {"go": [{"accession": "GO:0016835", "name": "carbon-oxygen lyase activity"}, {"accession": "GO:0004106", "name": "chorismate mutase activity"}, {"accession": "GO:0043904", "name": "isochorismate pyruvate lyase activity"}]}, "biological_process": {"go": [{"accession": "GO:0046417", "name": "chorismate metabolic process"}, {"accession": "GO:0042864", "name": "pyochelin biosynthetic process"}, {"accession": "GO:0009697", "name": "salicylic acid biosynthetic process"}]}}, "macromolecules": {"general": {"nr_of_chains": "2", "nr_of_unique_protein_segments": "1", "class": "Homooligomeric enzymes", "subclass": "Homodimeric enzymes", "note": "All chains according to the most probable oligomerization state stored in PDBe were considered."}, "chain": [{"id": "A", "name": "Isochorismate pyruvate lyase", "source_organism": "Pseudomonas aeruginosa", "uniprot": {"id": "Q51507", "start": "1", "end": "96", "coverage": "95%", "sequence": "MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQTRGAA", "length": "101"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "9", "region_end": "40"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "50", "region_end": "68"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "71", "region_end": "95"}, {"region_type": "pfam", "region_id": "PF01817", "region_name": "Chorismate mutase type II", "region_start": "13", "region_end": "90"}]}}, {"id": "B", "name": "Isochorismate pyruvate lyase", "source_organism": "Pseudomonas aeruginosa", "uniprot": {"id": "Q51507", "start": "1", "end": "92", "coverage": "91%", "sequence": "MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQTRGAA", "length": "101"}, "regions": {"region": [{"region_type": "secondary structure", "region_name": "helix", "region_start": "3", "region_end": "7"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "9", "region_end": "38"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "39", "region_end": "41"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "50", "region_end": "68"}, {"region_type": "secondary structure", "region_name": "helix", "region_start": "71", "region_end": "92"}, {"region_type": "pfam", "region_id": "PF01817", "region_name": "Chorismate mutase type II", "region_start": "13", "region_end": "90"}]}}]}, "evidence": {"evidence_level": "Indirect evidence", "evidence_coverage": "The full structure participates in mutual synergistic folding.", "sequence_domain": "Chorismate mutase type II", "complex_evidence": "The enzyme is an intertwined dimer of three helices with connecting loops. The N-terminal helices of the two monomers twine together to form an anti-parallel coiled-coil with a hydrophobic interaction surface. The loop between the first and second helices is disordered (PMID:16914555).", "chain_evidence": [{"chain_id": "A", "support": "N/A"}, {"chain_id": "B", "support": "N/A"}]}, "related_structures": {"id": ["MF7000162", "MF7000212", "MF7000163", "MF7000211", "MF7000164", "MF7000165", "MF7000209", "MF7000210"]}}}